We’ve named this remarkable peptide Regulate, reflecting its profound ability to harmonize multiple body systems simultaneously—like a master conductor that coordinates the intricate symphony of cardiovascular, nervous, immune, and digestive systems, creating optimal physiological balance and homeostasis.
What It Helps With
VIP stands as nature’s multi-system regulator, offering comprehensive support for complex physiological challenges across multiple organs:
Let’s break down how VIP functions as your body’s master regulatory system. This 28 amino acid neuropeptide belongs to the glucagon/secretin superfamily and represents one of nature’s most sophisticated multi-system coordinators, working through three distinct G-protein coupled receptors: VPAC1, VPAC2, and PAC1.
VIP’s mechanism centers on its ability to activate adenylyl cyclase, leading to increased cyclic adenosine monophosphate (cAMP) and protein kinase A (PKA) activation. This cascade triggers phosphorylation of CREB and other transcriptional factors, initiating gene expression pathways that regulate circadian rhythms, immune responses, and cellular metabolism.
In the cardiovascular system, VIP acts as a potent vasodilator, reducing pulmonary artery pressure and vascular resistance while improving cardiac contractility. Its anti-inflammatory properties work by preventing macrophage activation, promoting regulatory T-cell generation, and downregulating pro-inflammatory cytokines like TNF-alpha and IL-6.
The peptide’s neurological effects include synchronizing circadian rhythms through the suprachiasmatic nucleus, where it coordinates the master biological clock. VIP also provides neuroprotection by reducing oxidative stress, preventing amyloid-beta toxicity, and maintaining synaptic function in neurodegenerative conditions.
What makes VIP unique is its ability to restore homeostasis across multiple organ systems simultaneously. Rather than targeting single pathways, VIP acts as a systemic coordinator, harmonizing cardiovascular, immune, nervous, and digestive functions to restore optimal physiological balance.
Subcutaneous Injection Protocol:
Administration Timing:
Protocol Duration:
Note: VIP has a plasma half-life of approximately 2 minutes, but biological effects persist much longer through cellular signaling cascades.
VIP demonstrates an excellent safety profile with minimal reported adverse effects:
The peptide’s outstanding safety profile stems from its endogenous nature and physiological regulatory mechanisms.
Classification: Neuropeptide/Neuromodulator (Glucagon/Secretin Superfamily)
VIP is a naturally occurring 28 amino acid peptide hormone that functions as both a neurotransmitter and systemic regulator, belonging to the class II G-protein coupled receptor family.
28 amino acids – This peptide contains the complete sequence necessary for multi-receptor activation and comprehensive physiological regulation: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2.
Research compound –
While VIP itself is not FDA approved as a therapeutic agent, synthetic VIP analogs like Aviptadil have been studied in clinical trials for various conditions including COVID-19 respiratory failure and pulmonary arterial hypertension.
Intermediate – VIP requires careful management due to its:
Anti-Inflammatory Stack:
Cardiovascular Support Stack:
Neurological Protection Stack:
Digestive Health Stack:
Autoimmune Support Stack:
All combinations should be approached systematically with medical oversight, particularly given VIP’s multi-system effects.
In our nudaVitae protocols, VIP serves as the ultimate systems integrator for clients requiring comprehensive physiological rebalancing. We’ve observed consistently remarkable results in individuals with multi-system dysfunction, autoimmune conditions, and complex chronic health challenges.
Key Biomarkers We Monitor:
Clinical Insights: Our most successful VIP protocols combine strategic timing with comprehensive lifestyle optimization. We’ve found that clients who pair VIP with appropriate stress management, circadian hygiene, and anti-inflammatory nutrition see dramatically enhanced outcomes. The peptide seems to unlock the body’s natural regulatory mechanisms that have been disrupted by chronic stress, inflammation, or disease.
Notable Case Pattern: We frequently see remarkable responses in clients with complex, multi-system conditions that haven’t responded well to single-target therapies. VIP often serves as the missing regulatory piece that allows other therapeutic interventions to work effectively by restoring fundamental physiological coordination and homeostasis.
nudaLabs VIP (6mg) Vial Specifications:
Molecular Information:
Quality Standards:
Storage & Handling:
Quality Control Testing: Every batch undergoes comprehensive analysis including:
Administration Guidelines:
Compliance & Safety:
VIP represents the pinnacle of multi-system physiological regulation, offering comprehensive support that works across cardiovascular, immune, nervous, and digestive systems simultaneously.
When integrated thoughtfully into comprehensive health optimization protocols, it offers the potential to restore the fundamental regulatory mechanisms that coordinate optimal health and homeostasis. This represents true systems medicine—addressing the root coordination of physiological function rather than isolated symptoms.
Yes. Every peptide we offer is sourced from FDA-registered compounding pharmacies or ISO-certified research laboratories that uphold the highest standards of purity, sterility, and identity verification. Each batch undergoes rigorous third-party testing for contaminants, potency, and peptide sequence accuracy. While peptides are not FDA approved for general medical use unless explicitly indicated, they are widely used under the regulatory classification of compounded or research compounds. At nudaLabs, we only work with vetted providers whose testing protocols and safety data meet or exceed regulatory expectations. Your safety is our baseline. Our protocols are built on trust, transparency, and clinically responsible use. This is the nuda way.
In some cases, yes. Some therapeutic peptides require a prescription and are dispensed through licensed compounding pharmacies. However, certain peptides are legally classified as “research-use only,” meaning they may be sold without a prescription depending on your jurisdiction and intended use. At nudaLabs, we guide you through this landscape with precision and integrity. Our process begins with the first clinically integrated AI tool for peptide protocol personalization (called the nudaVitae – include link here). It is designed to align your biology, goals, and safety profile with the peptides best for your body. We also offer optional telehealth consultations with peptide consultants to ensure medical appropriateness, compliance, and clarity. Whether your protocol involves prescription compounds or research peptides, our care team will walk with you every step of the way, prioritizing safety, legality, and personalized optimization.
<p>All peptides are shipped directly from licensed U.S. pharmacies or ISO-certified labs to our facility in Bentonville, Arkansas, and then to your door in secure, temperature-controlled packaging. If the peptide requires cold-chain integrity (such as lyophilized powders or reconstituted vials), your order will include cold packs or insulated materials to maintain stability during transit. Most peptides are stable at room temperature for short durations, but we recommend immediate refrigeration upon arrival. Shipping includes detailed instructions for storage, handling, and reconstitution (if applicable). For added protection, tracking numbers and insurance are included with every shipment. At this time, we do not ship outside the United States.</p>
All peptides are shipped directly from licensed U.S. pharmacies or ISO-certified labs to our facility in Bentonville, Arkansas, and then to your door in secure, temperature-controlled packaging. If the peptide requires cold-chain integrity (such as lyophilized powders or reconstituted vials), your order will include cold packs or insulated materials to maintain stability during transit. Most peptides are stable at room temperature for short durations, but we recommend immediate refrigeration upon arrival. Shipping includes detailed instructions for storage, handling, and reconstitution (if applicable). For added protection, tracking numbers and insurance are included with every shipment. At this time, we do not ship outside the United States.
That’s exactly why nudaLabs exists. Rather than guessing or buying blindly, we invite you to complete a short intake and schedule a clinical consult through our platform. From there, we create your personalized nudaVitae, an elegant, biologically aligned peptide protocol based on your health history, goals, labs, and lifestyle. Whether you’re new to peptides or refining an existing protocol, our team tailors every recommendation with precision. The right peptide isn’t just about symptoms; it’s about rhythm, recovery, and the deeper story your body is telling. We help you listen.
We welcome thoughtful, patient-centered providers into our clinical and compounding network. If you’re interested in offering nuda protocols to your patients or integrating our peptides into your practice, your first step is to fill out our Provider Partnership Application [insert link]. Once submitted, our medical team will schedule a discovery call to explore alignment, licensing, fulfillment logistics, and collaborative care models. We offer white-labeled protocols, access to nuda-branded education, and optional telehealth coverage if needed. At nudaLabs, we don’t just distribute peptides we are building an ecosystems of care around them (technology, education, consultation, and implementation).
