LL-37 (5mg)

5 mg

We’ve named this remarkable peptide Sentinela, Portuguese for “sentinel,” honoring its role as our body’s natural guardian against pathogens and cellular dysfunction while maintaining the intricate balance of immune defense and healing.

What It Helps With

LL-37 stands as nature’s most sophisticated antimicrobial defense system, offering targeted support for complex immune and healing challenges:

  • Chronic infections that resist conventional treatments
  • Biofilm-associated infections (chronic sinusitis, dental infections, Lyme disease)
  • Compromised immune function and recurrent infections
  • Autoimmune conditions with inflammatory components (psoriasis, IBD)
  • Chronic wounds and impaired healing processes
  • Gut barrier dysfunction and intestinal permeability
  • Skin barrier compromise and recurring skin infections
  • Post-antibiotic recovery and microbiome restoration

Mechanism of Action (The Science Behind It)

Let’s break down how LL-37 operates as both shield and sword in your immune system. This 37 amino acid cathelicidin peptide represents the sole member of the human cathelicidin family, naturally produced by neutrophils, epithelial cells, and macrophages as your body’s first line of defense.

LL-37 functions through multiple sophisticated mechanisms that distinguish it from conventional antimicrobials. The peptide’s cationic (positively charged) structure allows it to selectively target negatively charged bacterial and viral membranes through electrostatic attraction, creating pores that lead to pathogen death while sparing host cells with different membrane compositions.

What makes LL-37 truly remarkable is its biofilm-disrupting capability. While most treatments struggle to penetrate the protective matrix that shields chronic infections, LL-37 directly binds to and destabilizes these biofilm structures, exposing hidden pathogens to immune detection and treatment.

Beyond direct antimicrobial action, LL-37 serves as an immune orchestrator, binding to specific receptors including P2X7 and FPRL1 to modulate immune cell behavior. It promotes chemotaxis (immune cell recruitment), regulates cytokine production to prevent excessive inflammation, and enhances angiogenesis for tissue repair. This sophisticated control system means LL-37 simultaneously combats pathogens while supporting the healing cascade.

Popular Use Cases

  • Individuals with Treatment-Resistant Infections:
    Those dealing with chronic sinusitis, recurring UTIs, or persistent infections that haven’t responded to multiple antibiotic courses.
  • Biofilm-Related Conditions:
    People managing chronic Lyme disease, dental infections, or any condition involving persistent bacterial communities.
  • Autoimmune Management:
    Individuals with psoriasis, inflammatory bowel disease, or autoimmune conditions triggered by infections or barrier dysfunction.
  • Gut Health Optimization:
    Those addressing leaky gut syndrome, SIBO, or chronic digestive inflammation.
  • Post-Antibiotic Recovery:
    People seeking to restore immune function and microbiome balance after extensive antibiotic treatments.
  • Chronic Wound Management:
    Individuals with diabetic ulcers, surgical wounds, or injuries that heal poorly.

Dosage + Duration

Subcutaneous Injection Protocol:

  • Chronic Infection Management:
    100-300 mcg administered 1-3 times weekly for 8-12 weeks
  • Biofilm Disruption:
    250-500 mcg administered 2-3 times weekly for 4-8 weeks
  • Immune Modulation:
    100-200 mcg administered 1-2 times weekly for 8-12 weeks
  • Acute Infection Support:
    200-500 mcg administered 3 times weekly for 4-6 weeks

Topical Application (when appropriate):

  • Wound Healing:
    0.5-1 mg per cm² of affected area twice daily
  • Skin Barrier Support:
    Applied as directed by healthcare provider

Cycling Recommendations:

  • Active Treatment:
    4-12 weeks continuous use depending on condition severity
  • Rest Period:
    4-8 weeks off between cycles
  • Maintenance:
    Quarterly 4-week protocols for chronic conditions

Note: LL-37 has a circulatory half-life of 90-120 minutes, with sustained immunological effects lasting significantly longer through triggered cellular cascades.

Side Effects

LL-37 demonstrates excellent tolerability as a naturally occurring human peptide, with minimal reported adverse effects:

  • Injection Site Reactions:
    Mild irritation, redness, or temporary discomfort at injection sites
  • Initial Immune Activation:
    Some individuals may experience temporary inflammatory responses as immune function normalizes
  • Rare Systemic Effects:
    Occasional mild fatigue or flu-like symptoms during initial treatment
  • Autoimmune Considerations:
    Potential temporary flare in some autoimmune conditions before improvement

The peptide’s excellent safety profile stems from its natural presence in human immune defense systems, making it highly biocompatible with minimal risk of adverse reactions.

Peptide Type

Classification: Antimicrobial Peptide (AMP)/Immune Modulator

LL-37 is the human cathelicidin family’s sole member, representing our body’s primary endogenous antimicrobial defense peptide naturally produced within immune and epithelial cells.

Number of Amino Acids

37 amino acids – This cathelicidin contains the precise sequence necessary for selective pathogen targeting while preserving beneficial microbiota and supporting tissue repair.

FDA Status

Research compound only –

LL-37 is not FDA approved for any medical condition and remains classified as an investigational compound with extensive safety research backing.

Experience Level

Advanced – LL-37 requires careful protocol guidance due to its:

  • Complex immune modulation effects that require monitoring
  • Potential for immune activation responses
  • Need for precise dosing strategies based on individual immune status
  • Sophisticated understanding of immune system interactions

Popular Combinations (Stacks)

Chronic Infection Stack:

  • LL-37 + BPC-157 (antimicrobial action + tissue healing synergy)
  • LL-37 + KPV (immune modulation + anti-inflammatory balance)

Autoimmune Balance Stack:

  • LL-37 + Thymosin Alpha-1 (comprehensive immune system support)
  • LL-37 + KPV (targeted immune modulation with inflammation control)

Gut Health Stack:

  • LL-37 + BPC-157 (barrier restoration + antimicrobial protection)

Wound Healing Stack:

  • LL-37 + BPC-157 + TB-500 (comprehensive healing with infection protection)

Advanced stacking should be approached systematically under professional guidance, introducing peptides individually to assess immune responses.

nudaLabs Clinical Note

In our nudaVitae protocols, LL-37 serves as a sophisticated immune system modulator for clients addressing complex infectious or inflammatory challenges requiring nuanced immune support. We’ve observed particularly impressive results in clients with treatment-resistant infections and autoimmune conditions where infectious triggers contribute to disease progression.

Key Biomarkers We Monitor:

  • Inflammatory markers (CRP, ESR, IL-6, TNF-alpha)
  • Immune function indicators (white blood cell differential, immunoglobulins)
  • Antimicrobial peptide levels (when available)
  • Barrier function markers (lactulose/mannitol ratio, zonulin)
  • Infection-specific markers (culture results, pathogen load)
  • Autoimmune activity indicators (condition-specific markers)

Clinical Insights: Our most successful LL-37 protocols combine targeted antimicrobial therapy with comprehensive immune system support. We’ve found that clients who pair LL-37 with anti-inflammatory nutrition, stress management, and appropriate sleep optimization see significantly enhanced outcomes. The peptide seems to restore immune system balance rather than simply stimulating or suppressing immune function.

Notable Case Pattern: We frequently see remarkable responses in clients with “treatment-resistant” infections, particularly those with biofilm-associated conditions or chronic infections that recur despite multiple conventional treatments. LL-37 often serves as the key that finally allows the immune system to effectively clear persistent pathogens.

Product Specifications & Quality Assurance

nudaLabs LL-37 (5mg) Vial Specifications:

Molecular Information:

  • CAS Number: 154947-66-7
  • Molecular Weight: 4493.28 Da
  • Molecular Formula: C205H340N60O53S2
  • Amino Acid Sequence: [LL-37, 37 aa]
  • Peptide Classification: Cathelicidin antimicrobial peptide (37 amino acids)

Quality Standards:

  • Purity: ≥98% (verified by HPLC-MS)
  • Appearance: White to off-white lyophilized powder
  • Solubility: Readily soluble in sterile water or bacteriostatic water
  • Endotoxin Level: <1.0 EU/mg
  • Manufacturing: USA facility under ISO 9001:2015 standards
  • Synthesis Method: Solid Phase Peptide Synthesis (SPPS)

Storage & Handling:

  • Storage Temperature: -20°C (standard freezer) before reconstitution
  • Shelf Life: 24 months when stored properly and protected from light
  • Reconstituted Storage: 2-8°C (refrigerator) for up to 4-6 weeks
  • Recommended Reconstitution: Bacteriostatic water at 1-2mg/mL concentration

Quality Control Testing: Every batch undergoes comprehensive analysis including:

  • High-Performance Liquid Chromatography (HPLC) for purity verification
  • Mass Spectrometry (MS) for molecular weight confirmation
  • Amino acid analysis for sequence verification
  • Endotoxin testing for safety assurance
  • Antimicrobial activity assays for biological potency
  • Sterility testing where applicable

Compliance & Safety:

  • Research Use Only: This product is intended for laboratory research purposes only
  • Not for Human Consumption: Not approved for therapeutic, diagnostic, or human use
  • FDA Status: Not approved by the FDA for any medical condition
  • Batch Tracking: Each vial includes unique lot numbers and QR codes for full traceability
  • Certificate of Analysis (COA): Available for each batch upon request

LL-37 represents the pinnacle of immune system optimization, a compound that works within your body’s natural defense mechanisms to restore balance and function.

When integrated thoughtfully into comprehensive health protocols, it offers the potential to overcome complex immune challenges that conventional approaches struggle to address.

Are your peptides safe and lab-tested?

Yes. Every peptide we offer is sourced from FDA-registered compounding pharmacies or ISO-certified research laboratories that uphold the highest standards of purity, sterility, and identity verification. Each batch undergoes rigorous third-party testing for contaminants, potency, and peptide sequence accuracy. While peptides are not FDA approved for general medical use unless explicitly indicated, they are widely used under the regulatory classification of compounded or research compounds. At nudaLabs, we only work with vetted providers whose testing protocols and safety data meet or exceed regulatory expectations. Your safety is our baseline. Our protocols are built on trust, transparency, and clinically responsible use. This is the nuda way.

In some cases, yes. Some therapeutic peptides require a prescription and are dispensed through licensed compounding pharmacies. However, certain peptides are legally classified as “research-use only,” meaning they may be sold without a prescription depending on your jurisdiction and intended use. At nudaLabs, we guide you through this landscape with precision and integrity. Our process begins with the first clinically integrated AI tool for peptide protocol personalization (called the nudaVitae – include link here). It is designed to align your biology, goals, and safety profile with the peptides best for your body. We also offer optional telehealth consultations with peptide consultants to ensure medical appropriateness, compliance, and clarity. Whether your protocol involves prescription compounds or research peptides, our care team will walk with you every step of the way, prioritizing safety, legality, and personalized optimization.

<p>All peptides are shipped directly from licensed U.S. pharmacies or ISO-certified labs to our facility in Bentonville, Arkansas, and then to your door in secure, temperature-controlled packaging. If the peptide requires cold-chain integrity (such as lyophilized powders or reconstituted vials), your order will include cold packs or insulated materials to maintain stability during transit. Most peptides are stable at room temperature for short durations, but we recommend immediate refrigeration upon arrival. Shipping includes detailed instructions for storage, handling, and reconstitution (if applicable). For added protection, tracking numbers and insurance are included with every shipment. At this time, we do not ship outside the United States.</p>

All peptides are shipped directly from licensed U.S. pharmacies or ISO-certified labs to our facility in Bentonville, Arkansas, and then to your door in secure, temperature-controlled packaging. If the peptide requires cold-chain integrity (such as lyophilized powders or reconstituted vials), your order will include cold packs or insulated materials to maintain stability during transit. Most peptides are stable at room temperature for short durations, but we recommend immediate refrigeration upon arrival. Shipping includes detailed instructions for storage, handling, and reconstitution (if applicable). For added protection, tracking numbers and insurance are included with every shipment. At this time, we do not ship outside the United States.

That’s exactly why nudaLabs exists. Rather than guessing or buying blindly, we invite you to complete a short intake and schedule a clinical consult through our platform. From there, we create your personalized nudaVitae, an elegant, biologically aligned peptide protocol based on your health history, goals, labs, and lifestyle. Whether you’re new to peptides or refining an existing protocol, our team tailors every recommendation with precision. The right peptide isn’t just about symptoms; it’s about rhythm, recovery, and the deeper story your body is telling. We help you listen.

We welcome thoughtful, patient-centered providers into our clinical and compounding network. If you’re interested in offering nuda protocols to your patients or integrating our peptides into your practice, your first step is to fill out our Provider Partnership Application [insert link]. Once submitted, our medical team will schedule a discovery call to explore alignment, licensing, fulfillment logistics, and collaborative care models. We offer white-labeled protocols, access to nuda-branded education, and optional telehealth coverage if needed. At nudaLabs, we don’t just distribute peptides we are building an ecosystems of care around them (technology, education, consultation, and implementation).

Frequently Asked Question

Explore Our Peptides

GLP1-R Revolution (24mg)
GLP1-T Harmony (100 mg)
GLP1-T Harmony (60 mg)
KLOW (GHK-cu 50mg/BPC-157 10mg/TB500 10mg/KPV 10mg)